-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYH14 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human MYH14 (NP_079005.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MYH14 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human MYH14 (NP_079005.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15950A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYH14 |
| Target Synonyms | DFNA4; MHC16; MYH17; PNMHH; DFNA4A; myosin; FP17425; NMHC II-C; NMHC-II-C; MYH14 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse lung, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MYH14 (NP_079005.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNH | Uniprot ID | Q7Z406 |
Uniprot Id
Q7Z406
Target Species
Human
Target Name
MYH14
Target Full Name
Myosin-14
Target Function
Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.
Target Involvement
Deafness, autosomal dominant, 4A (DFNA4A); Peripheral neuropathy, myopathy, hoarseness, and hearing loss (PNMHH)
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Target Tissue Specificity
High levels of expression are found in brain (highest in corpus callosum), heart, kidney, liver, lung, small intestine, colon and skeletal muscle. Expression is low in organs composed mainly of smooth muscle, such as aorta, uterus and urinary bladder. No
Target Synonyms
2400004E04Rik; DFNA4; DKFZp667A1311; FLJ13881; FLJ43092; FP17425; II C; KIAA2034; MHC16; Myh 14; MYH14; MYH14_HUMAN; Myosin 14; Myosin; Myosin heavy chain 14; Myosin heavy chain; Myosin heavy chain non muscle IIc; Myosin heavy polypeptide 14; Myosin-14; NMHC II C; NMHC II-C; Non muscle myosin heavy chain IIc; non-muscle IIc; Non-muscle myosin heavy chain IIc; Nonmuscle myosin heavy chain II C; OTTMUSP00000019210
Target Background
This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin; it should not be confused with the unconventional myosin-14 (MYO14). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene result in one form of autosomal dominant hearing impairment. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification