-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYO18A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1970-2054 of human MYO18A (NP_510880.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYO18A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1970-2054 of human MYO18A (NP_510880.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08938A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYO18A |
| Target Synonyms | MAJN; TIAF1; MYSPDZ; SPR210; SP-R210; MYO18A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Jurkat, Mouse brain, Mouse liver, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1970-2054 of human MYO18A (NP_510880.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLTETNA | Uniprot ID | Q92614 |
Uniprot Id
Q92614
Target Species
Human
Target Name
MYO18A
Target Full Name
Unconventional myosin-XVIIIa
Target Function
May link Golgi membranes to the cytoskeleton and participate in the tensile force required for vesicle budding from the Golgi. Thereby, may play a role in Golgi membrane trafficking and could indirectly give its flattened shape to the Golgi apparatus. Alternatively, in concert with LURAP1 and CDC42BPA/CDC42BPB, has been involved in modulating lamellar actomyosin retrograde flow that is crucial to cell protrusion and migration. May be involved in the maintenance of the stromal cell architectures required for cell to cell contact. Regulates trafficking, expression, and activation of innate immune receptors on macrophages. Plays a role to suppress inflammatory responsiveness of macrophages via a mechanism that modulates CD14 trafficking. Acts as a receptor of surfactant-associated protein A (SFTPA1/SP-A) and plays an important role in internalization and clearance of SFTPA1-opsonized S.aureus by alveolar macrophages. Strongly enhances natural killer cell cytotoxicity.
Target Subcellular Location
Golgi apparatus. Golgi apparatus, trans-Golgi network. Golgi outpost. Cytoplasm, cytoskeleton, microtubule organizing center.; [Isoform 1]: Endoplasmic reticulum-Golgi intermediate compartment. Cytoplasm, cytoskeleton.; [Isoform 2]: Cytoplasm.; [Isoform 5]: Cell surface.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Target Synonyms
MYO18A; CD245; KIAA0216; MYSPDZ; Unconventional myosin-XVIIIa; Molecule associated with JAK3 N-terminus; MAJN; Myosin containing a PDZ domain; Surfactant protein receptor SP-R210; SP-R210
Target Background
The protein encoded by this gene can bind GOLPH3, linking the Golgi to the cytoskeleton and influencing Golgi membrane trafficking. The encoded protein is also part of a complex that assembles lamellar actomyosin bundles and may be required for cell migration.
Notification