-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NBAS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NBAS (NP_056993.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NBAS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NBAS (NP_056993.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03900A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NBAS |
| Target Synonyms | NAG; SOPH; ILFS2; NBAS | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, K-562 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NBAS (NP_056993.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAPESGPALSPGTAEGEEETILYDLLVNTEWPPETEVQPRGNQKHGASFIITKAIRDRLLFLRQYIWYS | Uniprot ID | A2RRP1 |
Uniprot Id
A2RRP1
Target Species
Human
Target Name
NBAS
Target Full Name
NBAS subunit of NRZ tethering complex
Target Function
Involved in Golgi-to-endoplasmic reticulum (ER) retrograde transport; the function is proposed to depend on its association in the NRZ complex which is believed to play a role in SNARE assembly at the ER.
Target Involvement
Short stature, optic nerve atrophy, and Pelger-Huet anomaly (SOPH); Infantile liver failure syndrome 2 (ILFS2)
Target Subcellular Location
Cytoplasm. Endoplasmic reticulum. Endoplasmic reticulum membrane; Peripheral membrane protein.
Target Tissue Specificity
Broadly expressed, with highest levels in heart and skeletal muscle, and lowest levels in liver, small intestine and thymus. Well expressed in retinal ganglion cells, epidermal skin cells, and leukocytes. Up-regulated together with N-myc in some neuroblas
Target Synonyms
NBAS; NBAS_HUMAN; Neuroblastoma-amplified gene protein; Neuroblastoma-amplified sequence
Target Background
This gene encodes a protein with two leucine zipper domains, a ribosomal protein S14 signature domain and a Sec39 like domain. The protein is thought to be involved in Golgi-to-ER transport. Mutations in this gene are associated with short stature, optic nerve atrophy, and Pelger-Huet anomaly.
Notification