Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NKD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NKD1 (NP_149110.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NKD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NKD1 (NP_149110.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07103A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NKD1 |
| Target Synonyms | Naked1; NKD1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NKD1 (NP_149110.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGVSGPRQLRLAGTIGRSTRELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSG | Uniprot ID | Q969G9 |
Uniprot Id
Q969G9
Target Species
Human
Target Name
NKD1
Target Full Name
Protein naked cuticle homolog 1
Target Function
Cell autonomous antagonist of the canonical Wnt signaling pathway. May activate a second Wnt signaling pathway that controls planar cell polarity.
Target Subcellular Location
Cell membrane. Cytoplasm.
Target Protein Families
NKD family
Target Tissue Specificity
Expressed in colon, heart, kidney, leukocyte, liver, lung, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine and spleen.
Target Synonyms
NKD1; NKD; PP7246; Protein naked cuticle homolog 1; Naked-1; hNkd; hNkd1
Target Background
In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of the Wnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) signaling pathway.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
