-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NRCAM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-115 of human NRCAM (Q92823) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NRCAM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-115 of human NRCAM (Q92823) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07415A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NRCAM |
| Target Synonyms | NEDNMS; NRCAM | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse spinal cord, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-115 of human NRCAM (Q92823). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QMISALEVPLDPKLLEDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAE | Uniprot ID | Q92823 |
Uniprot Id
Q92823
Target Species
Human
Target Name
NRCAM
Target Full Name
Neuronal cell adhesion molecule
Target Function
Cell adhesion protein that is required for normal responses to cell-cell contacts in brain and in the peripheral nervous system. Plays a role in neurite outgrowth in response to contactin binding. Plays a role in mediating cell-cell contacts between Schwann cells and axons. Plays a role in the formation and maintenance of the nodes of Ranvier on myelinated axons. Nodes of Ranvier contain clustered sodium channels that are crucial for the saltatory propagation of action potentials along myelinated axons. During development, nodes of Ranvier are formed by the fusion of two heminodes. Required for normal clustering of sodium channels at heminodes; not required for the formation of mature nodes with normal sodium channel clusters. Required, together with GLDN, for maintaining NFASC and sodium channel clusters at mature nodes of Ranvier.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Secreted.
Target Protein Families
Immunoglobulin superfamily, L1/neurofascin/NgCAM family
Target Tissue Specificity
Detected in all the examined tissues. In the brain it was detected in the amygdala, caudate nucleus, corpus callosum, hippocampus, hypothalamus, substantia nigra, subthalamic nucleus and thalamus.
Target Synonyms
Bravo; hBravo; Neuronal cell adhesion molecule; Neuronal surface protein Bravo; Ng CAM related; Ng-CAM-related; NgCAM related cell adhesion molecule; NgCAM-related cell adhesion molecule; Nr CAM; Nr-CAM; Nrcam; NRCAM_HUMAN
Target Background
Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. This gene encodes a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. This gene is also expressed in non-neural tissues and may play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of this gene have been associated with autism and addiction vulnerability. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification