Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NTS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-148 of human NTS (NP_006174.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NTS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-148 of human NTS (NP_006174.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09280A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NTS |
| Target Synonyms | NN; NT; NT/N; NTS1; NMN-125; NTS | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-148 of human NTS (NP_006174.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYIL | Uniprot ID | P30990 |
Uniprot Id
P30990
Target Species
Human
Target Name
NTS
Target Full Name
Neurotensin/neuromedin N
Target Function
Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
Target Subcellular Location
Secreted. Cytoplasmic vesicle, secretory vesicle. Note=Packaged within secretory vesicles.
Target Protein Families
Neurotensin family
Target Research Area
Neuroscience
Target Synonyms
Human proneurotensin; Large neuromedin N; Neuromedin N preproprotein; Neurotensin/neuromedin N; NEUT_HUMAN; NMN 125; NmN; NmN-125; NN; NT; NT/N; NTRH; NTS; NTS1; Pro neurotensin/neuromedin; Proneuromedin N mRNA; Tail peptide
Target Background
This gene encodes a common precursor for two peptides, neuromedin N and neurotensin. Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. It may be involved in dopamine-associated pathophysiological events, in the maintenance of gut structure and function, and in the regulation of fat metabolism. Neurotensin also exhibits antimicrobial activity against bacteria and fungi. Tissue-specific processing may lead to the formation in some tissues of larger forms of neuromedin N and neurotensin. The large forms may represent more stable peptides that are also biologically active.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
