-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Nuclear Matrix Protein p84 (THOC1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human Nuclear Matrix Protein p84 (THOC1) (NP_005122.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Nuclear Matrix Protein p84 (THOC1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human Nuclear Matrix Protein p84 (THOC1) (NP_005122.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16627A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Nuclear Matrix Protein p84 (THOC1) |
| Target Synonyms | P84; HPR1; P84N5; DFNA86; Nuclear Matrix Protein p84 (THOC1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Mouse brain, Mouse spleen, Mouse testis, Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Nuclear Matrix Protein p84 (THOC1) (NP_005122.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPEDFLGKGPTKKILMGNEELTRLWNLCPDNME | Uniprot ID | Q96FV9 |
Uniprot Id
Q96FV9
Target Species
Human
Target Name
THOC1
Target Full Name
THO complex subunit 1
Target Function
Required for efficient export of polyadenylated RNA. Acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. Regulates transcriptional elongation of a subset of genes. Involved in genome stability by preventing co-transcriptional R-loop formation.; Participates in an apoptotic pathway which is characterized by activation of caspase-6, increases in the expression of BAK1 and BCL2L1 and activation of NF-kappa-B. This pathway does not require p53/TP53, nor does the presence of p53/TP53 affect the efficiency of cell killing. Activates a G2/M cell cycle checkpoint prior to the onset of apoptosis. Apoptosis is inhibited by association with RB1.
Target Subcellular Location
[Isoform 1]: Nucleus speckle. Nucleus, nucleoplasm. Nucleus matrix. Cytoplasm. Note=Can shuttle between the nucleus and cytoplasm. Nuclear localization is required for induction of apoptotic cell death. Translocates to the cytoplasm during the early phase of apoptosis execution.; [Isoform 2]: Cytoplasm.
Target Tissue Specificity
Ubiquitous. Expressed in various cancer cell lines. Expressed at very low levels in normal breast epithelial cells and highly expressed in breast tumors. Expression is strongly associated with an aggressive phenotype of breast tumors and expression correl
Target Synonyms
hTREX84; Death domain containing protein p84N5; HPR 1; HPR1; hTREX84; Nuclear matrix protein p84; P84; p84N5; Tho 1; THO complex 1; THO complex subunit 1; Tho1; THOC 1; Thoc1; THOC1_HUMAN
Target Background
Predicted to enable DNA binding activity and RNA binding activity. Involved in several processes, including negative regulation of DNA damage checkpoint; regulation of nucleobase-containing compound metabolic process; and viral mRNA export from host cell nucleus. Located in cytoplasm and nuclear speck. Part of THO complex part of transcription export complex. Colocalizes with chromosome, telomeric region.
Notification