-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OAS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human OAS1 (NP_058132.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OAS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human OAS1 (NP_058132.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10188A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OAS1 |
| Target Synonyms | OIAS; IFI-4; OIASI; IMD100; E18/E16; OAS1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OAS1 (NP_058132.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQ | Uniprot ID | P00973 |
Uniprot Id
P00973
Target Species
Human
Target Name
OAS1
Target Full Name
2'-5'-oligoadenylate synthase 1
Target Function
Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L.
Target Subcellular Location
Cytoplasm. Mitochondrion. Nucleus. Microsome. Endoplasmic reticulum. Secreted.
Target Protein Families
2-5A synthase family
Target Synonyms
OIAS; IFI-4; OIASI; IMD100; E18/E16; OAS1
Target Background
This interferon-induced gene encodes a protein that synthesizes 2', 5'-oligoadenylates (2-5As). This protein plays a key role in innate cellular antiviral response, and has been implicated in other cellular processes like cell growth and apoptosis. Alternative splicing results in multiple transcript variants with different enzymatic activities. Polymorphisms in this gene have been associated with susceptibility to viral infection, including SARS-CoV-2, and diabetes mellitus, type 1. This gene is located in a cluster of related genes on chromosome 12.
Notification