-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ODF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human ODF1 (NP_077721.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ODF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human ODF1 (NP_077721.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04683A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ODF1 |
| Target Synonyms | ODF; RT7; ODF2; ODFP; SODF; CT133; ODF27; ODFPG; HSPB10; ODFPGA; ODFPGB; ODF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human ODF1 (NP_077721.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC | Uniprot ID | Q14990 |
Uniprot Id
Q14990
Target Species
Human
Target Name
ODF1
Target Full Name
Outer dense fiber protein 1
Target Function
Component of the outer dense fibers (ODF) of spermatozoa. ODF are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail.
Target Tissue Specificity
Testis.
Target Synonyms
Cancer/testis antigen 133; CT133; HSPB10; ODF; Odf1; ODF2; ODF27; ODFP; ODFP1_HUMAN; ODFPG; ODFPGA; ODFPGB; Outer dense fiber of sperm tails 1; Outer dense fiber of sperm tails, 27 kD; Outer dense fiber protein 1; RT7; SODF
Target Background
The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. The human outer dense fibers contains at least 10 major proteins and this gene encodes the main protein.
Notification