Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OLIG3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 163-272 of human OLIG3 (NP_786923.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OLIG3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 163-272 of human OLIG3 (NP_786923.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06092A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OLIG3 |
| Target Synonyms | Bhlhb7; bHLHe20; OLIG3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 163-272 of human OLIG3 (NP_786923.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TVGHSAGHPAHAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK | Uniprot ID | Q7RTU3 |
Uniprot Id
Q7RTU3
Target Species
Human
Target Name
OLIG3
Target Full Name
Oligodendrocyte transcription factor 3
Target Function
May determine the distinct specification program of class A neurons in the dorsal part of the spinal cord and suppress specification of class B neurons.
Target Subcellular Location
Nucleus.
Target Synonyms
Basic helix loop helix domain containing class B protein 7; Basic helix-loop-helix domain-containing protein, class B, 7; bHLHB7; bHLHe20; Class B basic helix loop helix protein 7; Class B basic helix-loop-helix protein 7; Class E basic helix loop helix protein 20; Class E basic helix-loop-helix protein 20; Olig3; OLIG3_HUMAN; Oligo3; Oligodendrocyte lineage transcription factor 3; Oligodendrocyte specific bHLH transcription factor 3; Oligodendrocyte transcription factor 3
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
