-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ORC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 696-856 of human ORC1 (NP_001177748.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ORC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 696-856 of human ORC1 (NP_001177748.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05470A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ORC1 |
| Target Synonyms | ORC1L; PARC1; HSORC1; ORC1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, A-431, A-549, Jurkat, K-562, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 696-856 of human ORC1 (NP_001177748.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EDDAIQLVARKVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAIKNSSVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKDE | Uniprot ID | Q13415 |
Uniprot Id
Q13415
Target Species
Human
Target Name
ORC1
Target Full Name
Origin recognition complex subunit 1
Target Function
Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.
Target Involvement
Meier-Gorlin syndrome 1 (MGORS1)
Target Subcellular Location
Nucleus.
Target Protein Families
ORC1 family
Target Research Area
Others
Target Synonyms
HSORC1; MmORC1; orc1; ORC1_HUMAN; ORC1L; Origin Recognition Complex 1; Origin recognition complex subunit 1 (yeast homolog) like; Origin recognition complex subunit 1; Origin recognition complex subunit 1 homolog; Origin recognition complex subunit 1 like (S. cerevisia; Origin recognition complex subunit 1 like; Origin recognition complex subunit 1 S. cerevisiae homolog like ; Origin recognition complex, subunit 1 like (yeast); PARC1; Replication control protein 1
Target Background
The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is the largest subunit of the ORC complex. While other ORC subunits are stable throughout the cell cycle, the levels of this protein vary during the cell cycle, which has been shown to be controlled by ubiquitin-mediated proteolysis after initiation of DNA replication. This protein is found to be selectively phosphorylated during mitosis. It is also reported to interact with MYST histone acetyltransferase 2 (MyST2/HBO1), a protein involved in control of transcription silencing. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification