-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 341-441 of human PAX3 (NP_852122.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 341-441 of human PAX3 (NP_852122.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05934A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAX3 |
| Target Synonyms | WS1; WS3; CDHS; HUP2; PAX-3; PAX3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 341-441 of human PAX3 (NP_852122.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDS | Uniprot ID | P23760 |
Uniprot Id
P23760
Target Species
Human
Target Name
PAX3
Target Full Name
Paired box protein Pax-3
Target Function
Transcription factor that may regulate cell proliferation, migration and apoptosis. Involved in neural development and myogenesis. Transcriptional activator of MITF, acting synergistically with SOX10.
Target Involvement
Waardenburg syndrome 1 (WS1); Waardenburg syndrome 3 (WS3); Craniofacial-deafness-hand syndrome (CDHS); Rhabdomyosarcoma 2 (RMS2)
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family
Target Synonyms
CDHS; HUP 2; HUP2; MGC120381; MGC120382; MGC120383; MGC120384; MGC134778; Paired box 3; Paired box gene 3; Paired box homeotic gene 3; Paired box protein Pax 3; Paired box protein Pax-3; Paired box protein Pax3; Paired domain gene 3; Paired domain gene HuP2; PAX 3; Pax3; PAX3/FKHR fusion gene; PAX3_HUMAN; Sp; splotch; Waardenburg syndrome 1; WS 1; WS1; WS3
Target Background
This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini.
Notification