Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDIA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PDIA4 (NP_004902.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PDIA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PDIA4 (NP_004902.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10678A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDIA4 |
| Target Synonyms | ERP70; ERP72; ERp-72; PDIA4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, MCF7, Mouse liver, Rat liver, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PDIA4 (NP_004902.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFL | Uniprot ID | P13667 |
Uniprot Id
P13667
Target Species
Human
Target Name
PDIA4
Target Full Name
Protein disulfide-isomerase A4
Target Subcellular Location
Endoplasmic reticulum lumen. Melanosome.
Target Protein Families
Protein disulfide isomerase family
Target Synonyms
Calcium binding protein intestinal related; Endoplasmic reticulum resident protein 70; Endoplasmic reticulum resident protein 72; EPR70; EPR72; ER protein 70; ER protein 72; ERP 70; ERp 72; ERp-72; ERp70; ERp72; PDIA 4; Pdia4; PDIA4_HUMAN; PDIR; Protein disulfide isomerase A4; Protein disulfide isomerase associated 4; Protein disulfide isomerase family A member 4; protein disulfide isomerase related protein (calcium-binding protein; intestinal-related); Protein disulfide isomerase related protein; Protein disulfide-isomerase A4; Protein ERp 72; Protein ERp72
Target Background
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, three catalytically active thioredoxin (TRX) domains, two TRX-like domains and a C-terminal ER-retention sequence. This protein, when bound to cyclophilin B, enhances the rate of immunoglobulin G intermolecular disulfide bonding and antibody assembly.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
