-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDLIM4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-210 of human PDLIM4 (NP_003678.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PDLIM4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-210 of human PDLIM4 (NP_003678.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04342A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDLIM4 |
| Target Synonyms | RIL; PDLIM4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, Mouse brain, PC-3, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 80-210 of human PDLIM4 (NP_003678.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSRPEGRSWPSAPDDSKAQAHRIHIDPEIQDGSPTTSRRPSGTGTGPEDGRPSLGSPYGQPPRFPVPHNGSSEATLPAQMSTLHVSPPPSADPARGLPRSRDCRVDLGSEVYRMLREPAEPVAAEPKQSGS | Uniprot ID | P50479 |
Uniprot Id
P50479
Target Species
Human
Target Name
PDLIM4
Target Full Name
PDZ and LIM domain protein 4
Target Function
Suppresses SRC activation by recognizing and binding to active SRC and facilitating PTPN13-mediated dephosphorylation of SRC 'Tyr-419' leading to its inactivation. Inactivated SRC dissociates from this protein allowing the initiation of a new SRC inactivation cycle. Involved in reorganization of the actin cytoskeleton. In nonmuscle cells, binds to ACTN1 (alpha-actinin-1), increases the affinity of ACTN1 to F-actin (filamentous actin), and promotes formation of actin stress fibers. Involved in regulation of the synaptic AMPA receptor transport in dendritic spines of hippocampal pyramidal neurons directing the receptors toward an insertion at the postsynaptic membrane. Links endosomal surface-internalized GRIA1-containing AMPA receptors to the alpha-actinin/actin cytoskeleton. Increases AMPA receptor-mediated excitatory postsynaptic currents in neurons.; Involved in reorganization of the actin cytoskeleton and in regulation of cell migration. In response to oxidative stress, binds to NQO1, which stabilizes it and protects it from ubiquitin-independent degradation by the core 20S proteasome. Stabilized protein is able to heterodimerize with isoform 1 changing the subcellular location of it from cytoskeleton and nuclei to cytosol, leading to loss of isoforms 1 ability to induce formation of actin stress fibers. Counteracts the effects produced by isoform 1 on organization of actin cytoskeleton and cell motility to fine-tune actin cytoskeleton rearrangement and to attenuate cell migration.
Target Subcellular Location
[Isoform 1]: Cytoplasm, cytoskeleton. Nucleus. Cytoplasm. Cytoplasm, perinuclear region. Cell projection, lamellipodium. Cell projection, dendritic spine. Early endosome membrane; Peripheral membrane protein; Cytoplasmic side. Recycling endosome membrane; Peripheral membrane protein; Cytoplasmic side. Cell junction, synapse, synaptosome.; [Isoform 2]: Cytoplasm.
Target Tissue Specificity
[Isoform 2]: Found in brain.
Target Synonyms
Enigma homolog; LIM domain protein; LIM domain protein RIL; LIM protein RIL; PDLI4_HUMAN; PDLIM 4; PDLIM4; PDZ and LIM domain 4; PDZ and LIM domain protein 4; Reversion induced LIM protein; Reversion-induced LIM protein
Target Background
Enables alpha-actinin binding activity; protein homodimerization activity; and protein phosphatase binding activity. Involved in actin cytoskeleton reorganization. Located in several cellular components, including lamellipodium; perinuclear region of cytoplasm; and stress fiber. Part of filamentous actin. Implicated in osteoporosis.
Notification