-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PEBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PEBP1 (P30086) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PEBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PEBP1 (P30086) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15808A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PEBP1 |
| Target Synonyms | PBP; HCNP; PEBP; RKIP; HCNPpp; PEBP-1; HEL-210; HEL-S-34; HEL-S-96; PEBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, Mouse brain, Mouse liver, Mouse thymus, Rat liver, Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PEBP1 (P30086). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSG | Uniprot ID | P30086 |
Uniprot Id
P30086
Target Species
Human
Target Name
PEBP1
Target Full Name
Phosphatidylethanolamine-binding protein 1
Target Function
Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase. Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation.; HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Phosphatidylethanolamine-binding protein family
Target Synonyms
Epididymis luminal protein 210; Epididymis secretory protein Li 34; Epididymis secretory protein Li 96; HCNP; HCNPpp; HEL 210; HEL S 34; HEL S 96; Hippocampal cholinergic neurostimulating peptide; Neuropolypeptide h3; PBP; PEBP ; PEBP 1; PEBP-1; Pebp1; PEBP1_HUMAN; Phosphatidylethanolamine binding protein ; Phosphatidylethanolamine binding protein 1; Prostatic binding protein ; Prostatic-binding protein; R kip; Raf kinase inhibitor protein; Raf kinase inhibitory protein; RKIP
Target Background
This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The encoded protein can be further processed to form a smaller cleavage product, hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in neural development. This gene has been implicated in numerous human cancers and may act as a metastasis suppressor gene. Multiple pseudogenes of this gene have been identified in the genome.
Notification