-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Peroxiredoxin 1 (PAG) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Peroxiredoxin 1 (PAG) (NP_060910.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Peroxiredoxin 1 (PAG) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Peroxiredoxin 1 (PAG) (NP_060910.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06690A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Peroxiredoxin 1/PAG |
| Target Synonyms | CBP; PAG; Peroxiredoxin 1 (PAG) | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Peroxiredoxin 1 (PAG) (NP_060910.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQR | Uniprot ID | Q9NWQ8 |
Uniprot Id
Q9NWQ8
Target Species
Human
Target Name
PAG1
Target Full Name
Phosphoprotein associated with glycosphingolipid-enriched microdomains 1
Target Function
Negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Promotes CSK activation and recruitment to lipid rafts, which results in LCK inhibition. Inhibits immunological synapse formation by preventing dynamic arrangement of lipid raft proteins. May be involved in cell adhesion signaling.
Target Subcellular Location
Cell membrane; Single-pass type III membrane protein. Note=Present in lipid rafts.
Target Tissue Specificity
Ubiquitously expressed. Present in germinal center B-cells, plasma cells, T-cells, monocytes and platelets (at protein level).
Target Research Area
Cell Biology
Target Synonyms
CBP; Csk binding protein; Csk-binding protein; FLJ37858; MGC138364; PAG 1; PAG; PAG1; PAG1_HUMAN; Phosphoprotein associated with glycosphingolipid enriched microdomains 1; Phosphoprotein associated with glycosphingolipid enriched microdomains; Phosphoprotein associated with glycosphingolipid microdomains 1; Phosphoprotein associated with glycosphingolipid-enriched microdomains 1; Protein Associated with Glycosphingolipid Enriched Microdomains; Transmembrane adapter protein PAG; Transmembrane phosphoprotein Cbp
Target Background
The protein encoded by this gene is a type III transmembrane adaptor protein that binds to the tyrosine kinase csk protein. It is thought to be involved in the regulation of T cell activation.
Notification