Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PHC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-323 of human PHC2 (NP_004418.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PHC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-323 of human PHC2 (NP_004418.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05543A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PHC2 |
| Target Synonyms | PH2; EDR2; HPH2; PHC2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, DU145, HT-29, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-323 of human PHC2 (NP_004418.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS | Uniprot ID | Q8IXK0 |
Uniprot Id
Q8IXK0
Target Species
Human
Target Name
PHC2
Target Full Name
Polyhomeotic-like protein 2
Target Function
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.
Target Subcellular Location
Nucleus.
Target Synonyms
EDR2; early development regulator 2 (homolog of polyhomeotic 2); early development regulator 2 like; Early development regulatory protein 2; HDC2 / PHC2; hPH2; MGC163502; mph2; PH2; PHC2; PHC2_HUMAN; polyhomeotic 2; polyhomeotic like 2; Polyhomeotic-like protein 2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
