-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIK3C3/VPS34 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 788-887 of human PIK3C3/VPS34 (Q8NEB9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against PIK3C3/VPS34 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 788-887 of human PIK3C3/VPS34 (Q8NEB9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-16572A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIK3C3/VPS34 |
| Target Synonyms | VPS34; Vps34; hVps34; PIK3C3/VPS34 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, RD | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 788-887 of human PIK3C3/VPS34 (Q8NEB9). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK | Uniprot ID | Q8NEB9 |
Uniprot Id
Q8NEB9
Target Species
Human
Target Name
PIK3C3
Target Full Name
Phosphatidylinositol 3-kinase catalytic subunit type 3
Target Function
Catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate; different complex forms are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagosomes and PI3KC3-C2 in maturation of autophagosomes and endocytosis. As part of PI3KC3-C1, promotes endoplasmic reticulum membrane curvature formation prior to vesicle budding. Involved in regulation of degradative endocytic trafficking and required for the abcission step in cytokinesis, probably in the context of PI3KC3-C2. Involved in the transport of lysosomal enzyme precursors to lysosomes. Required for transport from early to late endosomes.
Target Subcellular Location
Midbody. Late endosome. Cytoplasmic vesicle, autophagosome.
Target Protein Families
PI3/PI4-kinase family
Target Tissue Specificity
Ubiquitously expressed, with a highest expression in skeletal muscle.
Target Synonyms
hVps34; MGC61518; Phosphatidylinositol 3 kinase catalytic subunit type 3; Phosphatidylinositol 3 kinase class 3; Phosphatidylinositol 3 kinase p100 subunit; Phosphatidylinositol 3-kinase catalytic subunit type 3; Phosphatidylinositol 3-kinase p100 subunit; Phosphoinositide 3 kinase class 3; Phosphoinositide-3-kinase class 3; PI3 kinase type 3; PI3-kinase type 3; PI3K type 3; Pik3c3; PK3C3_HUMAN; PtdIns 3 kinase type 3; PtdIns-3-kinase type 3; Vps 34; Vps34
Target Background
Enables 1-phosphatidylinositol-3-kinase activity. Involved in early endosome to late endosome transport and regulation of cytokinesis. Acts upstream of or within autophagy and protein lipidation. Located in autolysosome; late endosome; and midbody.
Notification