-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLA2G1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-148 of human PLA2G1B (NP_000919.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PLA2G1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-148 of human PLA2G1B (NP_000919.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03768A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLA2G1B |
| Target Synonyms | PLA2; PLA2A; PPLA2; PLA2G1B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse pancreas, Mouse small intestine | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-148 of human PLA2G1B (NP_000919.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS | Uniprot ID | P04054 |
Uniprot Id
P04054
Target Species
Human
Target Name
PLA2G1B
Target Full Name
Phospholipase A2
Target Function
Secretory calcium-dependent phospholipase A2 that primarily targets dietary phospholipids in the intestinal tract. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity) with preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. May play a role in the biosynthesis of N-acyl ethanolamines that regulate energy metabolism and inflammation in the intestinal tract. Hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines. May act in an autocrine and paracrine manner. Upon binding to the PLA2R1 receptor can regulate podocyte survival and glomerular homeostasis. Has anti-helminth activity in a process regulated by gut microbiota. Upon helminth infection of intestinal epithelia, directly affects phosphatidylethanolamine contents in the membrane of helminth larvae, likely controlling an array of phospholipid-mediated cellular processes such as membrane fusion and cell division while providing for better immune recognition, ultimately reducing larvae integrity and infectivity.
Target Subcellular Location
Secreted. Note=Secreted from pancreatic acinar cells in its inactive form.
Target Protein Families
Phospholipase A2 family
Target Tissue Specificity
Selectively expressed in pancreas, lung, liver and kidney. Also detected at lower levels in ovary and testis.
Target Synonyms
Group IB phospholipase A2; Group IB secretory phospholipase A2 ; MGC119834; MGC119835; PA21B_HUMAN; Phosphatidylcholine 2 acylhydrolase; Phosphatidylcholine 2-acylhydrolase 1B; Phospholipase A2; Phospholipase A2 group IB (pancreas); Phospholipase A2 group IB; PLA 2; PLA2; PLA2A; PLA2G1B; PPLA 2; PPLA2; sPLA2IB
Target Background
This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response.
Notification