-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 940-1074 of human PLD1 (NP_002653.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against PLD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 940-1074 of human PLD1 (NP_002653.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-08197A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLD1 |
| Target Synonyms | PLD1; hPLD1; Phospholipase D1; Choline phosphatase 1; PLD 1; phospholipase D1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 940-1074 of human PLD1 (NP_002653.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VMDGKEYQAGRFARGLRLQCFRVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT | Uniprot ID | Q13393 |
Uniprot Id
Q13393
Target Species
Human
Target Name
PLD1
Target Full Name
Phospholipase D1
Target Function
Function as phospholipase selective for phosphatidylcholine. Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic.
Target Involvement
Cardiac valvular defect, developmental (CVDD)
Target Subcellular Location
Cytoplasm, perinuclear region. Endoplasmic reticulum membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus membrane; Lipid-anchor; Cytoplasmic side. Late endosome membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Phospholipase D family
Target Tissue Specificity
Expressed abundantly in the pancreas and heart and at high levels in brain, placenta, spleen, uterus and small intestine.
Target Synonyms
Choline phosphatase 1; hPLD1; Phosphatidylcholine-hydrolyzing phospholipase D1; Phospholipase D1; PLD 1; PLD1; PLD1_HUMAN
Target Background
This gene encodes a phosphatidylcholine-specific phospholipase which catalyzes the hydrolysis of phosphatidylcholine in order to yield phosphatidic acid and choline. The enzyme may play a role in signal transduction and subcellular trafficking. Alternative splicing results in multiple transcript variants with both catalytic and regulatory properties.
Notification