Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-150 of human PLP1 (NP_000524.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PLP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-150 of human PLP1 (NP_000524.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-01744A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLP1 |
| Target Synonyms | PLP; PMD; HLD1; MMPL; SPG2; GPM6C; PLP/DM20; PLP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-150 of human PLP1 (NP_000524.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPD | Uniprot ID | P60201 |
Uniprot Id
P60201
Target Species
Human
Target Name
PLP1
Target Full Name
Myelin proteolipid protein
Target Function
This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.
Target Involvement
Leukodystrophy, hypomyelinating, 1 (HLD1); Spastic paraplegia 2, X-linked (SPG2)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Myelin membrane.
Target Protein Families
Myelin proteolipid protein family
Target Synonyms
PLP1; PLP; Myelin proteolipid protein; Lipophilin
Target Background
This gene encodes a transmembrane proteolipid protein that is the predominant component of myelin. The encoded protein may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively splicing results in multiple transcript variants, including the DM20 splice variant.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
