-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POFUT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-370 of human POFUT2 (NP_056042.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against POFUT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-370 of human POFUT2 (NP_056042.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02255A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POFUT2 |
| Target Synonyms | FUT13; C21orf80; POFUT2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, HepG2, Mouse brain, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 240-370 of human POFUT2 (NP_056042.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAII | Uniprot ID | Q9Y2G5 |
Uniprot Id
Q9Y2G5
Target Species
Human
Target Name
POFUT2
Target Full Name
GDP-fucose protein O-fucosyltransferase 2
Target Function
Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in the consensus sequence C1-X(2,3)-S/T-C2-X(2)-G of thrombospondin type 1 repeats where C1 and C2 are the first and second cysteines, respectively. O-fucosylates members of several protein families including the ADAMTS family, the thrombosporin (TSP) and spondin families. The O-fucosylation of TSRs is also required for restricting epithelial to mesenchymal transition (EMT), maintaining the correct patterning of mesoderm and localization of the definite endoderm. Required for the proper secretion of ADAMTS family members such as ADAMSL1 and ADAMST13.
Target Subcellular Location
Endoplasmic reticulum. Golgi apparatus. Note=Mainly located in the endoplasmic reticulum.
Target Protein Families
Glycosyltransferase 68 family
Target Tissue Specificity
Isoform A is expressed in fetal liver and peripheral blood lymphocytes. Isoform B is expressed in spleen, lung, testis, bone marrow, thymus, pancreas, prostate, fetal brain, fetal liver and fetal kidney. Isoform C is expressed in brain, heart, spleen, liv
Target Synonyms
FUT13; C21orf80; POFUT2
Target Background
Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF; MIM 131530)-like repeats or thrombospondin (THBS; see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al., 2006 [PubMed 16464857]).
Notification