-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POU2F3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU2F3 (NP_055167.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POU2F3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU2F3 (NP_055167.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01219A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POU2F3 |
| Target Synonyms | PLA1; OCT11; PLA-1; Epoc-1; OCT-11; OTF-11; Skn-1a; POU2F3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU2F3 (NP_055167.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQGLQPNLLPFPQQQSGLLLPQTGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSG | Uniprot ID | Q9UKI9 |
Uniprot Id
Q9UKI9
Target Species
Human
Target Name
POU2F3
Target Full Name
POU domain, class 2, transcription factor 3
Target Function
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Regulated the expression of a number of genes such as SPRR2A or placental lactogen.
Target Subcellular Location
Nucleus.
Target Protein Families
POU transcription factor family, Class-2 subfamily
Target Tissue Specificity
Specifically expressed in epidermis and cultured keratinocytes.
Target Research Area
Others
Target Synonyms
class 2; Epoc 1; Epoc1; HGNC19864; Oct 11; Oct-11; OCT11; Octamer binding transcription factor 11; Octamer-binding protein 11; Octamer-binding transcription factor 11; OTF-11; PLA 1; PLA1; PLA1 protein ; PO2F3_HUMAN; POU class 2 homeobox 3; POU domain; POU domain transcription factor OCT11a; POU domain, class 2, transcription factor 3; POU transcription factor; POU2F3; Skn 1a; transcription factor 3; Transcription factor PLA-1; Transcription factor Skn-1; Transcription factor Skn1
Target Background
This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification