-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POU4F3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU4F3 (NP_002691.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POU4F3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU4F3 (NP_002691.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05869A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POU4F3 |
| Target Synonyms | BRN3C; DFNA15; DFNA42; DFNA52; POU4F3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU4F3 (NP_002691.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMAMNSKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSSTVPISHPAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDV | Uniprot ID | Q15319 |
Uniprot Id
Q15319
Target Species
Human
Target Name
POU4F3
Target Full Name
POU domain, class 4, transcription factor 3
Target Function
Acts as a transcriptional activator. Acts by binding to sequences related to the consensus octamer motif 5'-ATGCAAAT-3' in the regulatory regions of its target genes. Involved in the auditory system development, required for terminal differentiation of hair cells in the inner ear.
Target Involvement
Deafness, autosomal dominant, 15 (DFNA15)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
POU transcription factor family, Class-4 subfamily
Target Tissue Specificity
Brain. Seems to be specific to the retina.
Target Synonyms
Brain specific homeobox/POU domain protein 3C; Brain-3C; Brain-specific homeobox/POU domain protein 3C; BRN 3C; Brn-3C; BRN3C; class 4; DFNA 15; DFNA15; MGC138412; PO4F3_HUMAN; POU class 4 homeobox 3; POU domain; POU domain class 4 transcription factor 3; POU4F3; transcription factor 3
Target Background
This gene encodes a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. This protein is found in the retina and may play a role in determining or maintaining the identities of a small subset of visual system neurons. Defects in this gene are the cause of non-syndromic sensorineural deafness autosomal dominant type 15.
Notification