Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPIL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-492 of human PPIL4 (NP_624311.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PPIL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-492 of human PPIL4 (NP_624311.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00574A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPIL4 |
| Target Synonyms | HDCME13P; PPIL4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 301-492 of human PPIL4 (NP_624311.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPPNLVLKDKVKPKQDTKYDLILDEQAEDSKSSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLYERERSKKRDRSRSPKKSKDKEKSKYR | Uniprot ID | Q8WUA2 |
Uniprot Id
Q8WUA2
Target Species
Human
Target Name
PPIL4
Target Full Name
Peptidyl-prolyl cis-trans isomerase-like 4
Target Function
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Target Subcellular Location
Nucleus.
Target Protein Families
Cyclophilin-type PPIase family, PPIL4 subfamily
Target Tissue Specificity
Abundantly expressed in kidney but has a ubiquitously low expression pattern in other adult tissues.
Target Research Area
Signal Transduction
Target Synonyms
Cyclophilin type peptidyl prolyl cis trans isomerase; Cyclophilin-like protein PPIL4; HDCME13P; Peptidyl-prolyl cis-trans isomerase-like 4; Peptidylprolyl isomerase (cyclophilin) like 4; Peptidylprolyl Isomerase Like 4; PPIase; Ppil4; PPIL4_HUMAN; Rotamase; Rotamase PPIL4; serologically defined breast cancer antigen NY-BR-18
Target Background
This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
