Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPP1R7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 281-360 of human PPP1R7 (NP_002703.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPP1R7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 281-360 of human PPP1R7 (NP_002703.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03388A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPP1R7 |
| Target Synonyms | SDS22; PPP1R7 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 281-360 of human PPP1R7 (NP_002703.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF | Uniprot ID | Q15435 |
Uniprot Id
Q15435
Target Species
Human
Target Name
PPP1R7
Target Full Name
Protein phosphatase 1 regulatory subunit 7
Target Function
Regulatory subunit of protein phosphatase 1.
Target Subcellular Location
Nucleus.
Target Protein Families
SDS22 family
Target Tissue Specificity
Widely expressed.
Target Synonyms
PPP1R7; SDS22; Protein phosphatase 1 regulatory subunit 7; Protein phosphatase 1 regulatory subunit 22
Target Background
This gene encodes a protein subunit that regulates the activity of the serine/threonine phosphatase, protein phosphatase-1. The encoded protein is required for completion of the mitotic cycle and for targeting protein phosphatase-1 to mitotic kinetochores. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
