-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTPRE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human PTPRE (NP_006495.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PTPRE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human PTPRE (NP_006495.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02625A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTPRE |
| Target Synonyms | PTPE; HPTPE; R-PTP-EPSILON; PTPRE | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HL-60, Mouse brain, Mouse lung, Mouse spleen, Rat lung, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human PTPRE (NP_006495.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFRFRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKE | Uniprot ID | P23469 |
Uniprot Id
P23469
Target Species
Human
Target Name
PTPRE
Target Full Name
Receptor-type tyrosine-protein phosphatase epsilon
Target Function
Isoform 1 plays a critical role in signaling transduction pathways and phosphoprotein network topology in red blood cells. May play a role in osteoclast formation and function.; Isoform 2 acts as a negative regulator of insulin receptor (IR) signaling in skeletal muscle. Regulates insulin-induced tyrosine phosphorylation of insulin receptor (IR) and insulin receptor substrate 1 (IRS-1), phosphorylation of protein kinase B and glycogen synthase kinase-3 and insulin induced stimulation of glucose uptake.; Isoform 1 and isoform 2 act as a negative regulator of FceRI-mediated signal transduction leading to cytokine production and degranulation, most likely by acting at the level of SYK to affect downstream events such as phosphorylation of SLP76 and LAT and mobilization of Ca(2+).
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm.; [Isoform 3]: Cytoplasm.
Target Protein Families
Protein-tyrosine phosphatase family, Receptor class 4 subfamily
Target Tissue Specificity
Expressed in giant cell tumor (osteoclastoma rich in multinucleated osteoclastic cells).
Target Synonyms
PTPRE; Receptor-type tyrosine-protein phosphatase epsilon; Protein-tyrosine phosphatase epsilon; R-PTP-epsilon
Target Background
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Several alternatively spliced transcript variants of this gene have been reported, at least two of which encode a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains; another one encodes a PTP that contains a distinct hydrophilic N-terminus, and thus represents a nonreceptor-type isoform of this PTP. Studies of the similar gene in mice suggested the regulatory roles of this PTP in RAS related signal transduction pathways, cytokine-induced SATA signaling, as well as the activation of voltage-gated K+ channels.
Notification