Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PYGM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 743-842 of human PYGM (NP_005600.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PYGM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 743-842 of human PYGM (NP_005600.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10872A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PYGM |
| Target Synonyms | GSD5; PYGM | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse lung, Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 743-842 of human PYGM (NP_005600.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEAI | Uniprot ID | P11217 |
Uniprot Id
P11217
Target Species
Human
Target Name
PYGM
Target Full Name
Glycogen phosphorylase, muscle form
Target Function
Allosteric enzyme that catalyzes the rate-limiting step in glycogen catabolism, the phosphorolytic cleavage of glycogen to produce glucose-1-phosphate, and plays a central role in maintaining cellular and organismal glucose homeostasis.
Target Involvement
Glycogen storage disease 5 (GSD5)
Target Protein Families
Glycogen phosphorylase family
Target Synonyms
GSD5; PYGM
Target Background
This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
