Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB28 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-170 of human RAB28 (NP_001017979.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAB28 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-170 of human RAB28 (NP_001017979.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10459A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB28 |
| Target Synonyms | CORD18; RAB28 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-170 of human RAB28 (NP_001017979.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCF | Uniprot ID | P51157 |
Uniprot Id
P51157
Target Species
Human
Target Name
RAB28
Target Full Name
Ras-related protein Rab-28
Target Involvement
Cone-rod dystrophy 18 (CORD18)
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, cytoskeleton, cilium basal body.
Target Protein Families
Small GTPase superfamily, Rab family
Target Tissue Specificity
Isoform S is detected in most tissues investigated: cortex, liver, kidney, skeletal muscle, adipose tissue, testis, urothelium, lung, bone marrow and retinal pigment epithelium (RPE). Isoform L 2 is widely and abundantly expressed all tissues. Isoform 3 i
Target Synonyms
RAB28; Ras-related protein Rab-28
Target Background
This gene encodes a member of the Rab subfamily of Ras-related small GTPases. The encoded protein may be involved in regulating intracellular trafficking. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 9 and X.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
