-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB3GAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RAB3GAP2 (NP_036546.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAB3GAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RAB3GAP2 (NP_036546.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07005A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB3GAP2 |
| Target Synonyms | p150; SPG69; MARTS1; WARBM2; RAB3GAP150; RAB3-GAP150; RAB3GAP2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RAB3GAP2 (NP_036546.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MACSIVQFCYFQDLQAARDFLFPHLREEILSGALRRDPSKSTDWEDDGWGAWEENEPQEPEEEGNTCKTQKTSWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSGSLNVEEGECVTSALCIPLASQKRSSTGRPDWTCIVVGFTSGYVRFYTENGVLLLAQLLNEDPVLQLKCRTYEIPRHPG | Uniprot ID | Q9H2M9 |
Uniprot Id
Q9H2M9
Target Species
Human
Target Name
RAB3GAP2
Target Full Name
Rab3 GTPase-activating protein non-catalytic subunit
Target Function
Regulatory subunit of a GTPase activating protein that has specificity for Rab3 subfamily (RAB3A, RAB3B, RAB3C and RAB3D). Rab3 proteins are involved in regulated exocytosis of neurotransmitters and hormones. Rab3 GTPase-activating complex specifically converts active Rab3-GTP to the inactive form Rab3-GDP. Required for normal eye and brain development. May participate in neurodevelopmental processes such as proliferation, migration and differentiation before synapse formation, and non-synaptic vesicular release of neurotransmitters.
Target Involvement
Martsolf syndrome (MARTS); Warburg micro syndrome 2 (WARBM2)
Target Subcellular Location
Cytoplasm. Note=In neurons, it is enriched in the synaptic soluble fraction.
Target Protein Families
Rab3-GAP regulatory subunit family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
RAB3GAP2; KIAA0839; Rab3 GTPase-activating protein non-catalytic subunit; RGAP-iso; Rab3 GTPase-activating protein 150 kDa subunit; Rab3-GAP p150; Rab3-GAP150; Rab3-GAP regulatory subunit
Target Background
The protein encoded by this gene belongs to the RAB3 protein family, members of which are involved in regulated exocytosis of neurotransmitters and hormones. This protein forms the Rab3 GTPase-activating complex with RAB3GAP1, where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. This gene has the highest level of expression in the brain, consistent with it having a key role in neurodevelopment. Mutations in this gene are associated with Martsolf syndrome.
Notification