-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Rap1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 39-138 of human Rap1A (NP_002875.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Rap1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 39-138 of human Rap1A (NP_002875.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16523A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAP1A |
| Target Synonyms | RAP1; C21KG; G-22K; KREV1; KREV-1; SMGP21; 1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HL-60, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 39-138 of human Rap1A (NP_002875.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SYRKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQW | Uniprot ID | P62834 |
Uniprot Id
P62834
Target Species
Human
Target Name
RAP1A
Target Full Name
Ras-related protein Rap-1A
Target Function
Induces morphological reversion of a cell line transformed by a Ras oncogene. Counteracts the mitogenic function of Ras, at least partly because it can interact with Ras GAPs and RAF in a competitive manner. Together with ITGB1BP1, regulates KRIT1 localization to microtubules and membranes. Plays a role in nerve growth factor (NGF)-induced neurite outgrowth. Plays a role in the regulation of embryonic blood vessel formation. Involved in the establishment of basal endothelial barrier function. May be involved in the regulation of the vascular endothelial growth factor receptor KDR expression at endothelial cell-cell junctions.
Target Subcellular Location
Cell membrane; Lipid-anchor. Cytoplasm. Cytoplasm, perinuclear region. Cell junction. Early endosome.
Target Protein Families
Small GTPase superfamily, Ras family
Target Synonyms
C21KG; G 22K; G-22K; GTP binding protein smg p21A; GTP-binding protein smg p21A; KREV 1; KREV1; OTTHUMP00000013741; RAP 1A; RAP1; RAP1A; RAP1A member of RAS oncogene family; RAP1A_HUMAN; Ras related protein Krev 1; Ras related protein Rap 1A; RAS related protein RAP1A; Ras-related protein Krev-1; Ras-related protein Rap-1A; SMGP21
Target Background
This gene encodes a member of the Ras family of small GTPases. The encoded protein undergoes a change in conformational state and activity, depending on whether it is bound to GTP or GDP. This protein is activated by several types of guanine nucleotide exchange factors (GEFs), and inactivated by two groups of GTPase-activating proteins (GAPs). The activation status of the encoded protein is therefore affected by the balance of intracellular levels of GEFs and GAPs. The encoded protein regulates signaling pathways that affect cell proliferation and adhesion, and may play a role in tumor malignancy. Pseudogenes of this gene have been defined on chromosomes 14 and 17. Alternative splicing results in multiple transcript variants.
Notification