-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAP1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 81-181 of human RAP1B (NP_056461.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RAP1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 81-181 of human RAP1B (NP_056461.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08232A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAP1B |
| Target Synonyms | RAP1B; K-REV; RAL1B; ras-related protein Rap-1b | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 81-181 of human RAP1B (NP_056461.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSC | Uniprot ID | P61224 |
Uniprot Id
P61224
Target Species
Human
Target Name
RAP1B
Target Full Name
Ras-related protein Rap-1b
Target Function
GTP-binding protein that possesses intrinsic GTPase activity. Contributes to the polarizing activity of KRIT1 and CDH5 in the establishment and maintenance of correct endothelial cell polarity and vascular lumen. Required for the localization of phosphorylated PRKCZ, PARD3 and TIAM1 to the cell junction. Plays a role in the establishment of basal endothelial barrier function.
Target Subcellular Location
Cell membrane. Cytoplasm, cytosol. Cell junction. Note=May shuttle between plasma membrane and cytosol. Presence of KRIT1 and CDH5 is required for its localization to the cell junction.
Target Protein Families
Small GTPase superfamily, Ras family
Target Synonyms
GTP-binding protein smg p21B; K-REV; OK/SW-cl.11; RAL1B; rap1b; RAP1B member of RAS oncogene family; RAP1B_HUMAN; Ras family small GTP binding protein RAP1B; RAS related protein RAP1B; Ras-related protein Rap-1b; Small GTP binding protein
Target Background
This gene encodes a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. This protein localizes to cellular membranes and has been shown to regulate integrin-mediated cell signaling. This protein also plays a role in regulating outside-in signaling in platelets. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 5, 6 and 9.
Notification