Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBPMS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-219 of human RBPMS (NP_001008712.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RBPMS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-219 of human RBPMS (NP_001008712.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of Mouse ovary, using RBPMS Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
| Cat.No | ADA-00598A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBPMS |
| Target Synonyms | HERMES; RBPMS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse ovary | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-219 of human RBPMS (NP_001008712.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LVGTPNPSTPLPNTVPQFIAREPYELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQCFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC | Uniprot ID | Q93062 |
Uniprot Id
Q93062
Target Species
Human
Target Name
RBPMS
Target Full Name
RNA-binding protein with multiple splicing
Target Function
Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C-terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins. Binds to poly(A) RNA.
Target Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, P-body.
Target Tissue Specificity
Ubiquitously expressed, at various levels depending on the isoform and the tissue.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
FLJ32971; Heart and RRM expressed sequence; Hermes; RBP MS; RBP-MS; Rbpms; RBPMS_HUMAN; RNA binding protein gene with multiple splicing; RNA-binding protein with multiple splicing
Target Background
This gene encodes a member of the RNA recognition motif family of RNA-binding proteins. The RNA recognition motif is between 80-100 amino acids in length and family members contain one to four copies of the motif. The RNA recognition motif consists of two short stretches of conserved sequence, as well as a few highly conserved hydrophobic residues. The encoded protein has a single, putative RNA recognition motif in its N-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
