Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against REPIN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 376-567 of human REPIN1 (NP_037532.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against REPIN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 376-567 of human REPIN1 (NP_037532.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03048A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | REPIN1 |
| Target Synonyms | AP4; RIP60; ZNF464; Zfp464; REPIN1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Mouse liver, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 376-567 of human REPIN1 (NP_037532.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SCDDCGRSFRLERFLRAHQRQHTGERPFTCAECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEERLLAHQKKHDV | Uniprot ID | Q9BWE0 |
Uniprot Id
Q9BWE0
Target Species
Human
Target Name
REPIN1
Target Full Name
DNA-binding protein REPIN1
Target Function
Sequence-specific double-stranded DNA-binding protein required for initiation of chromosomal DNA replication. Binds on 5'-ATT-3' reiterated sequences downstream of the origin of bidirectional replication (OBR) and a second, homologous ATT sequence of opposite orientation situated within the OBR zone. Facilitates DNA bending.
Target Subcellular Location
Nucleus.
Target Synonyms
REPIN1; RIP60; ZNF464; Replication initiator 1; 60 kDa origin-specific DNA-binding protein; 60 kDa replication initiation region protein; ATT-binding protein; DHFR oribeta-binding protein RIP60; Zinc finger protein 464
Target Background
Enables RNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within positive regulation of glucose import and regulation of fatty acid transport. Located in nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
