Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 204-381 of human RNF13 (NP_009213.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNF13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 204-381 of human RNF13 (NP_009213.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01491A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF13 |
| Target Synonyms | RZF; DEE73; EIEE73; RNF13 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 204-381 of human RNF13 (NP_009213.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TKFVQDRHRARRNRLRKDQLKKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDSSQEENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTDSSDAENEINEHDVVVQLQPNGERDYNIANTV | Uniprot ID | O43567 |
Uniprot Id
O43567
Target Species
Human
Target Name
RNF13
Target Full Name
E3 ubiquitin-protein ligase RNF13
Target Function
E3 ubiquitin-protein ligase that may play a role in controlling cell proliferation. Involved in apoptosis regulation. Mediates ER stress-induced activation of JNK signaling pathway and apoptosis by promoting ERN1 activation and splicing of XBP1 mRNA.
Target Subcellular Location
Endoplasmic reticulum membrane. Golgi apparatus membrane. Late endosome membrane; Single-pass membrane protein. Lysosome membrane. Nucleus inner membrane.
Target Tissue Specificity
Widely expressed (at protein level). In normal pancreas, expressed in islets, but not in ducts, nor in acini (at protein level).
Target Research Area
Cell Biology
Target Synonyms
RNF13; RZF; E3 ubiquitin-protein ligase RNF13; RING finger protein 13; RING-type E3 ubiquitin transferase RNF13
Target Background
The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. The specific function of this gene has not yet been determined. Alternatively spliced transcript variants that encode the same protein have been reported. A pseudogene, which is also located on chromosome 3, has been defined for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
