Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPP38 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human RPP38 (NP_892117.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RPP38 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human RPP38 (NP_892117.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10189A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPP38 |
| Target Synonyms | RPP38 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human RPP38 (NP_892117.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVR | Uniprot ID | P78345 |
Uniprot Id
P78345
Target Species
Human
Target Name
RPP38
Target Full Name
Ribonuclease P protein subunit p38
Target Function
Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
Eukaryotic ribosomal protein eL8 family
Target Synonyms
RPP38; Ribonuclease P protein subunit p38; RNaseP protein p38; EC 3.1.26.5
Target Background
Enables ribonuclease P RNA binding activity. Contributes to ribonuclease P activity. Involved in tRNA 5'-leader removal. Located in fibrillar center. Part of multimeric ribonuclease P complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
