-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RRBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human RRBP1 (NP_004578.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RRBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human RRBP1 (NP_004578.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02263A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RRBP1 |
| Target Synonyms | RRp; hES; p180; ES130; ES/130; RRBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human RRBP1 (NP_004578.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKVEKKKKEKTVEKKGKTKKKEEKPNGKIPDHDPAPNVTVLLREPVRAPAVAVAPTPVQPPIIVAPVATVPAMPQEKLASSPKDKK | Uniprot ID | Q9P2E9 |
Uniprot Id
Q9P2E9
Target Species
Human
Target Name
RRBP1
Target Full Name
Ribosome-binding protein 1
Target Function
Acts as a ribosome receptor and mediates interaction between the ribosome and the endoplasmic reticulum membrane.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type III membrane protein.
Target Synonyms
180 kDa ribosome receptor homolog; DKFZp586A1420; ES/130; ES/130 related protein; ES/130-related protein; ES130; FLJ36146; hES; KIAA1398; MGC157720; MGC157721; Ribosome binding protein 1; Ribosome binding protein 1 homolog 180kDa; Ribosome binding protein 1 homolog; Ribosome receptor protein; Ribosome-binding protein 1; RRBP 1; Rrbp1; RRBP1_HUMAN; RRP
Target Background
This gene encodes a ribosome-binding protein of the endoplasmic reticulum (ER) membrane. Studies suggest that this gene plays a role in ER proliferation, secretory pathways and secretory cell differentiation, and mediation of ER-microtubule interactions. Alternative splicing has been observed and protein isoforms are characterized by regions of N-terminal decapeptide and C-terminal heptad repeats. Splicing of the tandem repeats results in variations in ribosome-binding affinity and secretory function. The full-length nature of variants which differ in repeat length has not been determined. Pseudogenes of this gene have been identified on chromosomes 3 and 7, and RRBP1 has been excluded as a candidate gene in the cause of Alagille syndrome, the result of a mutation in a nearby gene on chromosome 20p12.
Notification