-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Rubicon was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Rubicon (NP_055502.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Rubicon was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Rubicon (NP_055502.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03479A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Rubicon |
| Target Synonyms | SCAR15; RUBICON; KIAA0226; Rubicon | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Rubicon (NP_055502.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRPEGAGMELGGGEERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRDMQSILYHGLIRDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLL | Uniprot ID | Q92622 |
Uniprot Id
Q92622
Target Species
Human
Target Name
RUBCN
Target Full Name
Run domain Beclin-1-interacting and cysteine-rich domain-containing protein
Target Function
Inhibits PIK3C3 activity; under basal conditions negatively regulates PI3K complex II (PI3KC3-C2) function in autophagy. Negatively regulates endosome maturation and degradative endocytic trafficking and impairs autophagosome maturation process. Can sequester UVRAG from association with a class C Vps complex (possibly the HOPS complex) and negatively regulates Rab7 activation.; Involved in regulation of pathogen-specific host defense of activated macrophages. Following bacterial infection promotes NADH oxidase activity by association with CYBA thereby affecting TLR2 signaling and probably other TLR-NOX pathways. Stabilizes the CYBA:CYBB NADPH oxidase heterodimer, increases its association with TLR2 and its phagosome trafficking to induce antimicrobial burst of ROS and production of inflammatory cytokines. Following fungal or viral infection (implicating CLEC7A (dectin-1)-mediated myeloid cell activation or DDX58/RIG-I-dependent sensing of RNA viruses) negatively regulates pro-inflammatory cytokine production by association with CARD9 and sequestering it from signaling complexes.
Target Involvement
Spinocerebellar ataxia, autosomal recessive, 15 (SCAR15)
Target Subcellular Location
Late endosome. Lysosome. Early endosome. Note=Predominantly located in late endosomes/lysosomes, only partially detected in early endosome and not at all in the Golgi apparatus.
Target Synonyms
Baron; Beclin 1 associated RUN domain containing protein; Beclin-1 associated RUN domain containing protein; hypothetical protein LOC9711; Kiaa0226; OTTHUMP00000208021; OTTHUMP00000208023; OTTHUMP00000208024; RUBIC_HUMAN; Rubicon; RUN domain and cysteine rich domain containing, Beclin 1 interacting protein; Run domain Beclin 1 interacting and cystein rich containing protein; Run domain Beclin-1 interacting and cysteine-rich containing protein; RUN domain protein as Beclin 1 interacting and cysteine rich containing
Target Background
The protein encoded by this gene is a negative regulator of autophagy and endocytic trafficking and controls endosome maturation. This protein contains two conserved domains, an N-terminal RUN domain and a C-terminal DUF4206 domain. The RUN domain is involved in Ras-like GTPase signaling, and the DUF4206 domain contains a diacylglycerol (DAG) binding-like motif. Mutation in this gene results in deletion of the DAG binding-like motif and causes a recessive ataxia. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification