-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SF3B6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human SF3B6 (NP_057131.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SF3B6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human SF3B6 (NP_057131.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03428A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SF3B6 |
| Target Synonyms | P14; Ht006; SAP14; SAP14a; SF3B14; CGI-110; HSPC175; SF3B14a; SF3B6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human SF3B6 (NP_057131.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK | Uniprot ID | Q9Y3B4 |
Uniprot Id
Q9Y3B4
Target Species
Human
Target Name
SF3B6
Target Full Name
Splicing factor 3B subunit 6
Target Function
Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Directly contacts the pre-mRNA branch site adenosine for the first catalytic step of splicing. Enters the spliceosome and associates with the pre-mRNA branch site as part of the 17S U2 or, in the case of the minor spliceosome, as part of the 18S U11/U12 snRNP complex, and thus may facilitate the interaction of these snRNP with the branch sites of U2 and U12 respectively.
Target Subcellular Location
Nucleus.
Target Protein Families
SF3B6 family
Target Synonyms
Ht006; P14; PM14_HUMAN; Pre mRNA branch site protein p14; Pre-mRNA branch site protein p14; SAP14; SF3B 14 kDa subunit; SF3B14; SF3B14a; Splicing factor 3B, 14 kDa subunit
Target Background
This gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14 kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.
Notification