Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SIN3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SIN3B (NP_056075.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SIN3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SIN3B (NP_056075.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01646A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIN3B |
| Target Synonyms | SIN3B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-431, Mouse brain, Mouse testis, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SIN3B (NP_056075.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAHAGGGSGGSGAGGPAGRGLSGARWGRSGSAGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLTSQENSHNHGDGAEDFKQQVPYKEDKPQVPLESDSV | Uniprot ID | O75182 |
Uniprot Id
O75182
Target Species
Human
Target Name
SIN3B
Target Full Name
Paired amphipathic helix protein Sin3b
Target Function
Acts as a transcriptional repressor. Interacts with MXI1 to repress MYC responsive genes and antagonize MYC oncogenic activities. Interacts with MAD-MAX heterodimers by binding to MAD. The heterodimer then represses transcription by tethering SIN3B to DNA. Also forms a complex with FOXK1 which represses transcription. With FOXK1, regulates cell cycle progression probably by repressing cell cycle inhibitor genes expression.
Target Subcellular Location
Nucleus.
Target Synonyms
SIN3B; KIAA0700; Paired amphipathic helix protein Sin3b; Histone deacetylase complex subunit Sin3b; Transcriptional corepressor Sin3b
Target Background
Predicted to enable transcription corepressor activity. Predicted to be involved in histone deacetylation; negative regulation of transcription by RNA polymerase II; and striated muscle tissue development. Predicted to be located in nucleus. Predicted to be part of Sin3 complex. Predicted to be active in chromatin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
