Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC15A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human SLC15A1 (NP_005064.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC15A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human SLC15A1 (NP_005064.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06459A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC15A1 |
| Target Synonyms | PEPT1; HPECT1; HPEPT1; SLC15A1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human SLC15A1 (NP_005064.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVCVIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMS | Uniprot ID | P46059 |
Uniprot Id
P46059
Target Species
Human
Target Name
SLC15A1
Target Full Name
Solute carrier family 15 member 1
Target Function
Proton-coupled amino-acid transporter that transports oligopeptides of 2 to 4 amino acids with a preference for dipeptides. Primarily responsible for the absorption of dietary di- and tripeptides from the small intestinal lumen.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
PTR2/POT transporter (TC 2.A.17) family
Target Synonyms
+peptide cotransporter; HPECT1; HPEPT1; Human peptide transporter (HPEPT1) mRNA complete cds; Intestinal H; Intestinal H(+)/peptide cotransporter; Oligopeptide transporter; Oligopeptide transporter small intestine isoform; PEPT1; Peptide transporter 1; S15A1_HUMAN; Slc15a1; small intestine isoform; Solute carrier family 15 (oligopeptide transporter) member 1; Solute carrier family 15 member 1
Target Background
This gene encodes an intestinal hydrogen peptide cotransporter that is a member of the solute carrier family 15. The encoded protein is localized to the brush border membrane of the intestinal epithelium and mediates the uptake of di- and tripeptides from the lumen into the enterocytes. This protein plays an important role in the uptake and digestion of dietary proteins. This protein also facilitates the absorption of numerous peptidomimetic drugs.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
