Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC4A4 / NBC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 978-1078 of human SLC4A4 / NBC (NP_001091954.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SLC4A4 / NBC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 978-1078 of human SLC4A4 / NBC (NP_001091954.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09711A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC4A4 / NBC |
| Target Synonyms | KNBC; NBC1; NBC2; pNBC; HNBC1; NBCe1; hhNMC; kNBC1; SLC4A5; NBCe1-A; SLC4A4 / NBC | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, LNCaP, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 978-1078 of human SLC4A4 / NBC (NP_001091954.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS | Uniprot ID | Q9Y6R1 |
Uniprot Id
Q9Y6R1
Target Species
Human
Target Name
SLC4A4
Target Full Name
Electrogenic sodium bicarbonate cotransporter 1
Target Function
Electrogenic sodium/bicarbonate cotransporter with a Na(+):HCO3(-) stoichiometry varying from 1:2 to 1:3. May regulate bicarbonate influx/efflux at the basolateral membrane of cells and regulate intracellular pH.; May have a higher activity than isoform 1.
Target Involvement
Renal tubular acidosis, proximal, with ocular abnormalities and mental retardation (pRTA-OA)
Target Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein.
Target Protein Families
Anion exchanger (TC 2.A.31) family
Target Tissue Specificity
Isoform 1 is expressed in pancreas and to a lower extent in heart, skeletal muscle, liver, parotid salivary glands, prostate, colon, stomach, thyroid, brain and spinal chord. Corneal endothelium cells express only isoform 1 (at protein level). Isoform 2 i
Target Synonyms
DKFZp781H1314; Electrogenic sodium bicarbonate cotransporter 1; hhNMC; HNBC 1; HNBC1; kNBC 1; KNBC; kNBC1; Na(+)/HCO3(-) cotransporter; Na+HCO3- cotransporter 4; NBC 1; NBC 2; NBC1; NBC2; Nbc4; NBCE 1; NBCE1; OTTHUMP00000160355; OTTHUMP00000218884; OTTHUMP00000218885; PNBC; S4A4_HUMAN; SLC4A4; SLC4A5; Sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney, sodium bicarbonate cotransporter, pancreas); Sodium bicarbonate cotransporter; Sodium bicarbonate cotransporter kidney; sodium bicarbonate cotransporter member 4; Sodium bicarbonate cotransporter pancreas; Solute carrier family 4 member 4; Solute carrier family 4 sodium bicarbonate cotransporter member 4; Solute carrier family 4 sodium bicarbonate cotransporter member 5; Solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type
Target Background
This gene encodes a sodium bicarbonate cotransporter (NBC) involved in the regulation of bicarbonate secretion and absorption and intracellular pH. Mutations in this gene are associated with proximal renal tubular acidosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
