-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC9A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-600 of human SLC9A3 (NP_004165.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC9A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-600 of human SLC9A3 (NP_004165.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06925A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC9A3 |
| Target Synonyms | NHE3; DIAR8; NHE-3; SLC9A3 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 460-600 of human SLC9A3 (NP_004165.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VQWLKVKRSEHREPRLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSHFDRKFLSRVLMRRSAQKSRDRILNVFHELNLKDAISYVAEGERRGSLAFIRSPSTDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDMQS | Uniprot ID | P48764 |
Uniprot Id
P48764
Target Species
Human
Target Name
SLC9A3
Target Full Name
Sodium/hydrogen exchanger 3
Target Function
Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.
Target Involvement
Diarrhea 8, secretory sodium, congenital (DIAR8)
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein.
Target Protein Families
Monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family
Target Synonyms
MGC126718; MGC126720; Na(+)/H(+) exchanger 3; NHE 3; NHE-3; NHE3; SL9A3_HUMAN; SLC9A 3; Slc9a3; Sodium / Hydrogen Exchanger 3; Sodium/hydrogen exchanger 3; Sodium/hydrogen exchanger, apical epithelial; Solute carrier family 9 (sodium/hydrogen exchanger), isoform 3; Solute carrier family 9 (sodium/hydrogen exchanger), member 3; Solute carrier family 9 member 3
Target Background
The protein encoded by this gene is an epithelial brush border Na/H exchanger that uses an inward sodium ion gradient to expel acids from the cell. Defects in this gene are a cause of congenital secretory sodium diarrhea. Pseudogenes of this gene exist on chromosomes 10 and 22.
Notification