Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLITRK6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 621-816 of human SLITRK6 (NP_115605.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLITRK6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 621-816 of human SLITRK6 (NP_115605.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04107A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLITRK6 |
| Target Synonyms | DFNMYP; SLITRK6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 621-816 of human SLITRK6 (NP_115605.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVHLQYSMYGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQT | Uniprot ID | Q9H5Y7 |
Uniprot Id
Q9H5Y7
Target Species
Human
Target Name
SLITRK6
Target Full Name
SLIT and NTRK-like protein 6
Target Function
Regulator of neurite outgrowth required for normal hearing and vision.
Target Involvement
Deafness and myopia (DFNMYP)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
SLITRK family
Target Tissue Specificity
In adult brain, highly expressed in putamen with no expression in cerebral cortex. Expressed in adult and fetal lung and fetal liver. Also expressed at high levels in some brain tumors including medulloblastomas and primitive neuroectodermal tumors.
Target Synonyms
4832410J21Rik; DFNMYP; MGC119595; MGC119596; MGC119597; OTTHUMP00000066012; SLIK6_HUMAN; SLIT and NTRK like family member 6; SLIT and NTRK like protein 6; SLIT and NTRK-like protein 6; Slit and trk like 6; Slit and trk like gene 6; SLITRK 6; Slitrk6
Target Background
This gene encodes a member of the SLITRK protein family. Members of this family are integral membrane proteins that are characterized by two N-terminal leucine-rich repeat (LRR) domains and a C-terminal region that shares homology with trk neurotrophin receptors. This protein functions as a regulator of neurite outgrowth required for normal hearing and vision. Mutations in this gene are a cause of myopia and deafness.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
