Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNRPD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 8-121 of human SNRPD3 (NP_001265585) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SNRPD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 8-121 of human SNRPD3 (NP_001265585) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00562A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNRPD3 |
| Target Synonyms | SMD3; Sm-D3; SNRPD3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145, HT-29, Mouse brain, Mouse liver, Rat pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 8-121 of human SNRPD3 (NP_001265585). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNI | Uniprot ID | P62318 |
Uniprot Id
P62318
Target Species
Human
Target Name
SNRPD3
Target Full Name
Small nuclear ribonucleoprotein Sm D3
Target Function
Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone pre-mRNA 3'-end processing.
Target Subcellular Location
Cytoplasm, cytosol. Nucleus.
Target Protein Families
SnRNP core protein family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Sm D3; Sm-D3; small nuclear ribonucleoprotein D3 polypeptide 18kDa; Small nuclear ribonucleoprotein Sm D3; SmD3; SMD3_HUMAN; snRNP core protein D3; SNRPD3
Target Background
This gene encodes a core component of the spliceosome, which is a nuclear ribonucleoprotein complex that functions in pre-mRNA splicing. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
