-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOX10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human SOX10 (P56693) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against SOX10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human SOX10 (P56693) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-14172A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOX10 |
| Target Synonyms | DOM; WS4; PCWH; WS2E; WS4C; SOX-10; SOX10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SOX10 (P56693). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSH | Uniprot ID | P56693 |
Uniprot Id
P56693
Target Species
Human
Target Name
SOX10
Target Full Name
Transcription factor SOX-10
Target Function
Transcription factor that plays a central role in developing and mature glia. Specifically activates expression of myelin genes, during oligodendrocyte (OL) maturation, such as DUSP15 and MYRF, thereby playing a central role in oligodendrocyte maturation and CNS myelination. Once induced, MYRF cooperates with SOX10 to implement the myelination program. Transcriptional activator of MITF, acting synergistically with PAX3. Transcriptional activator of MBP, via binding to the gene promoter.
Target Involvement
Waardenburg syndrome 2E (WS2E); Waardenburg syndrome 4C (WS4C); Peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome and Hirschsprung disease (PCWH)
Target Subcellular Location
Cytoplasm. Nucleus. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side.
Target Tissue Specificity
Expressed in fetal brain and in adult brain, heart, small intestine and colon.
Target Synonyms
DOM; DOM; Dominant megacolon mouse human homolog of; MGC15649; PCWH; SOX 10; SOX10; SOX10_HUMAN; SRY (sex determining region Y) box 10; SRY (sex determining region Y) box 10; SRY box 10; SRY box containing gene 10; SRY related HMG box gene 10; SRY related HMG box gene 10; Transcription factor SOX 10; Transcription factor SOX-10; WS2E; WS4; WS4C
Target Background
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
Notification