-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOX17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 343-414 of human SOX17 (NP_071899.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SOX17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 343-414 of human SOX17 (NP_071899.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10590A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOX17 |
| Target Synonyms | VUR3; SOX17 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, Mouse lung, Mouse testis, Rat kidney, Rat uterus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 343-414 of human SOX17 (NP_071899.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RDGTDPSQPAELLGEVDRTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYCNYPDV | Uniprot ID | Q9H6I2 |
Uniprot Id
Q9H6I2
Target Species
Human
Target Name
SOX17
Target Full Name
Transcription factor SOX-17
Target Function
Acts as transcription regulator that binds target promoter DNA and bends the DNA. Binds to the sequences 5'-AACAAT-'3 or 5'-AACAAAG-3'. Modulates transcriptional regulation via WNT3A. Inhibits Wnt signaling. Promotes degradation of activated CTNNB1. Plays a key role in the regulation of embryonic development. Required for normal development of the definitive gut endoderm. Required for normal looping of the embryonic heart tube. Plays an important role in embryonic and postnatal vascular development, including development of arteries. Plays an important role in postnatal angiogenesis, where it is functionally redundant with SOX18. Required for the generation and maintenance of fetal hematopoietic stem cells, and for fetal hematopoiesis. Probable transcriptional activator in the premeiotic germ cells.
Target Involvement
Vesicoureteral reflux 3 (VUR3)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in adult heart, lung, spleen, testis, ovary, placenta, fetal lung, and kidney. In normal gastrointestinal tract, it is preferentially expressed in esophagus, stomach and small intestine than in colon and rectum.
Target Synonyms
FLJ22252; SOX17; SOX17_HUMAN; SRY (sex determining region Y) box 17; SRY box 17 ; SRY related HMG box transcription factor SOX17; Transcription factor SOX-17; Transcription factor SOX17; VUR3
Target Background
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.
Notification