Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPC24 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human SPC24 (NP_872319.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPC24 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human SPC24 (NP_872319.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08719A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPC24 |
| Target Synonyms | SPBC24; SPC24 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human SPC24 (NP_872319.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW | Uniprot ID | Q8NBT2 |
Uniprot Id
Q8NBT2
Target Species
Human
Target Name
SPC24
Target Full Name
Kinetochore protein Spc24
Target Function
Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore. The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules.
Target Subcellular Location
Nucleus. Chromosome, centromere, kinetochore.
Target Protein Families
SPC24 family
Target Synonyms
FLJ90806; hSpc24; Kinetochore protein Spc24; SPBC24; spc24; SPC24 NDC80 kinetochore complex component; SPC24 NDC80 kinetochore complex component homolog; SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae); SPC24_HUMAN; Spindle pole body component 24 homolog (S. cerevisiae); Spindle pole body component 24 homolog
Target Background
Predicted to be involved in cell division. Located in nucleolus and nucleoplasm. Part of Ndc80 complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
