Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPRY3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human SPRY3 (NP_005831.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPRY3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human SPRY3 (NP_005831.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05511A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPRY3 |
| Target Synonyms | spry-3; SPRY3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human SPRY3 (NP_005831.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TDDEDNCADEPCSCGPSSCFVRWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKAQEKSV | Uniprot ID | O43610 |
Uniprot Id
O43610
Target Species
Human
Target Name
SPRY3
Target Full Name
Protein sprouty homolog 3
Target Function
Inhibits neurite branching, arbor length and neurite complexity. Inhibits EGF-mediated p42/44 ERK signaling. Negatively regulates the MAPK cascade, resulting in a reduction of extracellular matrix protein accumulation. May function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Sprouty family
Target Tissue Specificity
Widely expressed; particularly in the fetal tissues. Expressed in the brain with expression the highest in Purkinje cells in the cerebellum (at protein level). Expressed in the myocardium of the heart.
Target Synonyms
SPRY3; Protein sprouty homolog 3; Spry-3
Target Background
Involved in negative regulation of MAPK cascade. Predicted to be located in membrane. Predicted to be active in cytosol.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
