Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STRBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-190 of human STRBP (NP_060857.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STRBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-190 of human STRBP (NP_060857.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05232A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STRBP |
| Target Synonyms | p74; SPNR; ILF3L; HEL162; STRBP | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-190 of human STRBP (NP_060857.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CALKHVSDWLDETNKGTKTEGETEVKKDEAGENYSKDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNTVKDNLPIQIQKLTEEKYQVEQCVNEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGENVSMKDPPDLL | Uniprot ID | Q96SI9 |
Uniprot Id
Q96SI9
Target Species
Human
Target Name
STRBP
Target Full Name
Spermatid perinuclear RNA-binding protein
Target Function
Involved in spermatogenesis and sperm function. Plays a role in regulation of cell growth. Binds to double-stranded DNA and RNA. Binds most efficiently to poly(I:C) RNA than to poly(dI:dC) DNA. Binds also to single-stranded poly(G) RNA. Binds non-specifically to the mRNA PRM1 3'-UTR and adenovirus VA RNA.
Target Subcellular Location
Cytoplasm.
Target Synonyms
Spermatid perinuclear RNA-binding protein; STRBP; STRBP_HUMAN
Target Background
Enables RNA binding activity. Predicted to be involved in spermatogenesis. Predicted to act upstream of or within mechanosensory behavior and spermatid development. Located in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
